PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI01G04650.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 296aa    MW: 31751.6 Da    PI: 6.0553
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI01G04650.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.41.4e-072994148
                     TSSS-HHHHHHHHHHHHHTTTT-HHH.HHHHHT.................TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWkt.Iartmg.................kgRtlkqcksrwqkyl 48
                     +g W++eEde+l+  ++  G  tW++ Iar +                  ++R++k+c++rw +yl
  ORUFI01G04650.1 29 KGLWSPEEDERLYTHITHRGVSTWSSlIARQVIwfldltrlalhsfhcagLRRSGKSCRLRWMNYL 94
                     678*******************997439999999999999999999******************97 PP

2Myb_DNA-binding40.94.8e-13103142445
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       +  E e ++ + k+lG++ W+ Ia++m+ gRt++++k++w+
  ORUFI01G04650.1 103 ISDREAETIISLQKLLGNR-WSVIAAKMP-GRTDNEIKNYWN 142
                      577899*************.*********.***********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500909.1172494IPR017877Myb-like domain
SMARTSM007170.00532896IPR001005SANT/Myb domain
SuperFamilySSF466891.22E-2128141IPR009057Homeodomain-like
PfamPF002498.8E-62994IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-1630101IPR009057Homeodomain-like
CDDcd001673.07E-43294No hitNo description
PROSITE profilePS5129420.55295149IPR017930Myb domain
SMARTSM007173.8E-1299147IPR001005SANT/Myb domain
CDDcd001672.55E-8102142No hitNo description
Gene3DG3DSA:1.10.10.609.9E-22102148IPR009057Homeodomain-like
PfamPF002491.1E-10104143IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MVRKPMSSRN GEAAAAAGGG GAAEEKERKG LWSPEEDERL YTHITHRGVS TWSSLIARQV  60
IWFLDLTRLA LHSFHCAGLR RSGKSCRLRW MNYLRPDLKK EPISDREAET IISLQKLLGN  120
RWSVIAAKMP GRTDNEIKNY WNSRIRKRQS AAAGAKGEPA PATVMEKEPT ANAATVAAAP  180
EAASPPPPPI PARLPMFSCQ LLDGGGSGGA TATTQSPPNA GSSDISEVSA CGGNGGGEDS  240
SRDYCFSGGD VDGDGDMVHL LALDDLDLLV DVPGLLDVDA WDCELYRADY STSRAR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-212914827127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0029120.0AP002912.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0028E10.
GenBankAP0033390.0AP003339.4 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:OJ1276_B06.
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAY4593430.0AY459343.1 Oryza sativa (japonica cultivar-group) clone CL018501.1 R2R3-MYB gene region.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645714.11e-130PREDICTED: myb-related protein Hv33-like
TrEMBLA0A0E0MRW60.0A0A0E0MRW6_ORYRU; Uncharacterized protein
STRINGBGIOSGA002307-PA1e-177(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP87032545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.18e-39myb domain protein 61